PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G037900.1
Common NamePHAVU_009G037900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 306aa    MW: 33547.9 Da    PI: 6.3863
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G037900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.31.2e-3067122359
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                         +vrY+eC+kNhA+s+GghavDGC+Ef+++ geegt +a+ CaAC+CHRnFHR+e + 
  Phvul.009G037900.1  67 TVRYRECQKNHAVSIGGHAVDGCCEFLAA-GEEGTLEAVICAACNCHRNFHRKEIDG 122
                         79**************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2153119IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.0E-2868120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-2669120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.99770119IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.83E-20201273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-32203275IPR009057Homeodomain-like
TIGRFAMsTIGR015654.8E-25215271IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEFHHHQDQE EEEEEEEEEE EEEEMGFSVA APGYDSFGNA AARSKITSAE GLPATVNSGR  60
KGGSTGTVRY RECQKNHAVS IGGHAVDGCC EFLAAGEEGT LEAVICAACN CHRNFHRKEI  120
DGEISPYQLR SQPQPQPLHP QYHHQFSPYY HRGPPPSSAG YLHHHHLLTP PVSQHRPLAL  180
PPLASGGVFS REEEDMSNPS SSGGGFGGGS GSGTKKRFRT KFTQEQKDKM LAFAEKLGWR  240
IQKHDEAAVE QFCAETCVKR HVLKVWMHNN KHTLANSEQR SAGNGSNHLN SSTIIANSEL  300
SPKGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-282142771679ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150350.0AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136351.10.0hypothetical protein PHAVU_009G037900g
SwissprotQ6YXH57e-78ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLV7ASQ10.0V7ASQ1_PHAVU; Uncharacterized protein
STRINGGLYMA06G09970.11e-160(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-63homeobox protein 22